PCDHA12 Antikörper (N-Term)

Produktnummer ABIN634732

Produktdetails anti-PCDHA12 Antikörper

Target: PCDHA12 (Protocadherin alpha 12 (PCDHA12))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCDHA12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCDHA12 antibody was raised against the N terminal of PCDHA12

Aufreinigung: Affinity purified

Immunogen: PCDHA12 antibody was raised using the N terminal of PCDHA12 corresponding to a region with amino acids EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCDHA12 Blocking Peptide, catalog no. 33R-2791, is also available for use as a blocking control in assays to test for specificity of this PCDHA12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCDHA12

Target: PCDHA12 (Protocadherin alpha 12 (PCDHA12))

Andere Bezeichnung: PCDHA12 (PCDHA12 Produkte)

Synonyme: PCDH-ALPHA12 antikoerper, Pcdha11 antikoerper, rCNRv12 antikoerper, Cnr5 antikoerper, Crnr5 antikoerper, Pcdha13 antikoerper, CNRv12 antikoerper, PCDHA12 antikoerper, protocadherin alpha 12 antikoerper, protocadherin alpha-12 antikoerper, PCDHA12 antikoerper, Pcdha12 antikoerper, LOC102147933 antikoerper

Hintergrund: PCDHA12 is a potential calcium-dependent cell-adhesion protein. PCDHA12 may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Molekulargewicht: 99 kDa (MW of target protein)