HABP2 Antikörper (Middle Region)

Produktnummer ABIN634644

Produktdetails anti-HABP2 Antikörper

Target: HABP2 (Hyaluronan Binding Protein 2 (HABP2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HABP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HABP2 antibody was raised against the middle region of HABP2

Aufreinigung: Affinity purified

Immunogen: HABP2 antibody was raised using the middle region of HABP2 corresponding to a region with amino acids EPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HABP2 Blocking Peptide, catalog no. 33R-2649, is also available for use as a blocking control in assays to test for specificity of this HABP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HABP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HABP2

Target: HABP2 (Hyaluronan Binding Protein 2 (HABP2))

Andere Bezeichnung: HABP2 (HABP2 Produkte)

Synonyme: HABP2 antikoerper, habp2 antikoerper, FSAP antikoerper, HABP antikoerper, HGFAL antikoerper, PHBP antikoerper, Fsap antikoerper, Habp antikoerper, Phbp antikoerper, AI035669 antikoerper, hyaluronan binding protein 2 antikoerper, hyaluronic acid binding protein 2 antikoerper, HABP2 antikoerper, habp2 antikoerper, Habp2 antikoerper

Hintergrund: HABP2 is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. It is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen.

Molekulargewicht: 63 kDa (MW of target protein)