MFAP4 Antikörper (N-Term)

Produktnummer ABIN634642

Produktdetails anti-MFAP4 Antikörper

Target: MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFAP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MFAP4 antibody was raised against the N terminal of MFAP4

Aufreinigung: Affinity purified

Immunogen: MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFAP4 Blocking Peptide, catalog no. 33R-9037, is also available for use as a blocking control in assays to test for specificity of this MFAP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFAP4

Target: MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))

Andere Bezeichnung: MFAP4 (MFAP4 Produkte)

Synonyme: 1110007F23Rik antikoerper, Magp-36 antikoerper, zgc:77076 antikoerper, microfibril-associated glycoprotein 4 antikoerper, microfibrillar-associated protein 4 antikoerper, microfibril associated protein 4 S homeolog antikoerper, microfibril associated protein 4 antikoerper, CpipJ_CPIJ000434 antikoerper, CpipJ_CPIJ006120 antikoerper, CpipJ_CPIJ010089 antikoerper, CpipJ_CPIJ018551 antikoerper, CpipJ_CPIJ020296 antikoerper, mfap4 antikoerper, mfap4.S antikoerper, MFAP4 antikoerper, Mfap4 antikoerper

Hintergrund: MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.

Molekulargewicht: 29 kDa (MW of target protein)