In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

ADAM Metallopeptidase Domain 12 (ADAM12) Antikörper

Antigen

ADAM Metallopeptidase Domain 12 (ADAM12)

Synonyme MCMP, MLTN, MLTNA, MCMPMltna, ADAM12, adam12
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN634632
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung ADAM12
Immunogen ADAM12 antibody was raised using a synthetic peptide corresponding to a region with amino acids VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE
Beschreibung ADAM12 is a member of the ADAM (a disintegrin and metalloprotease) protein family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis.
Molekulargewicht 58 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM12 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Proteolyse / Ubiquitin, Metalloprotease, Extrazelluläre Matrix, Proteasen

Alternativen

Alternativen zu Antigen "ADAM Metallopeptidase Domain 12 (ADAM12)", Typ "Antikörper" finden
Wirte Kaninchen (10), Ziege (7), Maus (4)
Reaktivitäten Human (17), Huhn (1), Rind (Kuh) (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (19), Enzyme Immunoassay (EIA) (5), ELISA (3), Immunhistochemie (Paraffinschnitte) (IHC (p)) (3), ELISA (Detektionsantikörper) (2), Dot Blot (Dot) (1), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (1), Immunhistochemie (IHC) (1)
Epitope N-Term (3), Cytoplasmic Domain Long Form (2)