PDCD7 Antikörper (Middle Region)
-
- Target Alle PDCD7 Antikörper anzeigen
- PDCD7 (Programmed Cell Death 7 (PDCD7))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDCD7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDCD7 antibody was raised against the middle region of PDCD7
- Aufreinigung
- Affinity purified
- Immunogen
- PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT
- Top Product
- Discover our top product PDCD7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDCD7 Blocking Peptide, catalog no. 33R-10177, is also available for use as a blocking control in assays to test for specificity of this PDCD7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDCD7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDCD7 (Programmed Cell Death 7 (PDCD7))
- Andere Bezeichnung
- PDCD7 (PDCD7 Produkte)
- Synonyme
- C80112 antikoerper, ES18 antikoerper, HES18 antikoerper, programmed cell death 7 antikoerper, Pdcd7 antikoerper, PDCD7 antikoerper
- Hintergrund
- PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells.
- Molekulargewicht
- 55 kDa (MW of target protein)
-