WWP1 Antikörper (N-Term)

Produktnummer ABIN634475

Produktdetails anti-WWP1 Antikörper

Target: WWP1 (WW Domain Containing E3 Ubiquitin Protein Ligase 1 (WWP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WWP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WWP1 antibody was raised against the N terminal of WWP1

Aufreinigung: Affinity purified

Immunogen: WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WWP1 Blocking Peptide, catalog no. 33R-1550, is also available for use as a blocking control in assays to test for specificity of this WWP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WWP1

Target: WWP1 (WW Domain Containing E3 Ubiquitin Protein Ligase 1 (WWP1))

Andere Bezeichnung: WWP1 (WWP1 Produkte)

Synonyme: AIP5 antikoerper, Tiul1 antikoerper, hSDRP1 antikoerper, 8030445B08Rik antikoerper, SDRP1 antikoerper, WWP1 antikoerper, aip5 antikoerper, tiul1 antikoerper, hsdrp1 antikoerper, WW domain containing E3 ubiquitin protein ligase 1 antikoerper, WWP1 antikoerper, Wwp1 antikoerper, wwp1 antikoerper

Hintergrund: WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing.

Molekulargewicht: 105 kDa (MW of target protein)