Calcyphosine Antikörper (N-Term)
-
- Target Alle Calcyphosine (CAPS) Antikörper anzeigen
- Calcyphosine (CAPS)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Calcyphosine Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CAPS antibody was raised against the N terminal of CAPS
- Aufreinigung
- Affinity purified
- Immunogen
- CAPS antibody was raised using the N terminal of CAPS corresponding to a region with amino acids DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA
- Top Product
- Discover our top product CAPS Primärantikörper
-
anti-Calcyphosine (CAPS) (AA 1-109) antibody
CAPS Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 4C6 unconjugated
anti-Calcyphosine (CAPS) (AA 1-189) antibodyCAPS Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyphosine (CAPS) (AA 1-189) antibodyCAPS Reaktivität: Human WB, IHC (p) Wirt: Maus Polyclonal unconjugated
anti-Calcyphosine (CAPS) (AA 1-189) antibodyCAPS Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyphosine (CAPS) (AA 1-189) antibodyCAPS Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyphosine (CAPS) (N-Term) antibodyCAPS Reaktivität: Human, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Calcyphosine (CAPS) (N-Term) antibodyCAPS Reaktivität: Human, Pferd, Schwein, Kaninchen, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CAPS Blocking Peptide, catalog no. 33R-1864, is also available for use as a blocking control in assays to test for specificity of this CAPS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calcyphosine (CAPS)
- Andere Bezeichnung
- CAPS (CAPS Produkte)
- Synonyme
- CAPS1 antikoerper, Caps antikoerper, Caps1 antikoerper, Caps2 antikoerper, caps1 antikoerper, MGC84373 antikoerper, CAPS antikoerper, calcyphosine antikoerper, calcium dependent secretion activator antikoerper, calcyphosine S homeolog antikoerper, CAPS antikoerper, Cadps antikoerper, caps.S antikoerper, caps antikoerper, Caps antikoerper
- Hintergrund
- CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.
- Molekulargewicht
- 21 kDa (MW of target protein)
-
