CANT1 Antikörper (Middle Region)

Produktnummer ABIN634381

Produktdetails anti-CANT1 Antikörper

Target: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CANT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CANT1 antibody was raised against the middle region of CANT1

Aufreinigung: Affinity purified

Immunogen: CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CANT1 Blocking Peptide, catalog no. 33R-8666, is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CANT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CANT1

Target: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Andere Bezeichnung: CANT1 (CANT1 Produkte)

Synonyme: DBQD antikoerper, SCAN-1 antikoerper, SCAN1 antikoerper, SHAPY antikoerper, 5830420C20Rik antikoerper, Apy1h antikoerper, D11Bwg0554e antikoerper, Entpd8 antikoerper, Shapy antikoerper, srapy antikoerper, apyrase antikoerper, xapy antikoerper, cant1 antikoerper, entpd8 antikoerper, zgc:85724 antikoerper, CANT1 antikoerper, zgc:101021 antikoerper, calcium activated nucleotidase 1 antikoerper, calcium activated nucleotidase 1 L homeolog antikoerper, calcium activated nucleotidase 1a antikoerper, calcium activated nucleotidase 1b antikoerper, CANT1 antikoerper, Cant1 antikoerper, cant1.L antikoerper, cant1 antikoerper, cant1a antikoerper, LOAG_01305 antikoerper, cant1b antikoerper

Hintergrund: CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP.

Molekulargewicht: 45 kDa (MW of target protein)