RAB18 Antikörper (C-Term)

Produktnummer ABIN634369

Produktdetails anti-RAB18 Antikörper

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB18 antibody was raised against the C terminal of RAB18

Aufreinigung: Affinity purified

Immunogen: RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB18 Blocking Peptide, catalog no. 33R-4939, is also available for use as a blocking control in assays to test for specificity of this RAB18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB18

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Andere Bezeichnung: RAB18 (RAB18 Produkte)

Synonyme: RAB18LI1 antikoerper, WARBM3 antikoerper, AA959686 antikoerper, RAB18 antikoerper, rab18li1 antikoerper, LOC100219058 antikoerper, rab18 antikoerper, zgc:92523 antikoerper, fc62e07 antikoerper, wu:fc62e07 antikoerper, zgc:77145 antikoerper, RAB18, member RAS oncogene family antikoerper, ras-related protein Rab-18-B antikoerper, ras-related protein Rab-18-like antikoerper, Ras-related protein Rab-18 antikoerper, RAB18, member RAS oncogene family S homeolog antikoerper, RAB18B, member RAS oncogene family antikoerper, RAB18A, member RAS oncogene family antikoerper, RAB18 antikoerper, Rab18 antikoerper, rab18 antikoerper, LOC100219058 antikoerper, rab-18 antikoerper, rab18.S antikoerper, rab18b antikoerper, rab18a antikoerper

Hintergrund: RAB18 belongs to the small GTPase superfamily.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom