MAP4K5 Antikörper (Middle Region)
-
- Target Alle MAP4K5 Antikörper anzeigen
- MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAP4K5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAP4 K5 antibody was raised against the middle region of MAP4 5
- Aufreinigung
- Affinity purified
- Immunogen
- MAP4 K5 antibody was raised using the middle region of MAP4 5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA
- Top Product
- Discover our top product MAP4K5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAP4K5 Blocking Peptide, catalog no. 33R-7562, is also available for use as a blocking control in assays to test for specificity of this MAP4K5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))
- Andere Bezeichnung
- MAP4K5 (MAP4K5 Produkte)
- Synonyme
- GCKR antikoerper, KHS antikoerper, KHS1 antikoerper, MAPKKKK5 antikoerper, 4432415E19Rik antikoerper, RGD1562028 antikoerper, fl74c10 antikoerper, wu:fl74c10 antikoerper, zgc:55719 antikoerper, zgc:55985 antikoerper, mitogen-activated protein kinase kinase kinase kinase 5 antikoerper, mitogen-activated protein kinase kinase kinase kinase 5 S homeolog antikoerper, MAP4K5 antikoerper, Map4k5 antikoerper, map4k5 antikoerper, map4k5.S antikoerper
- Hintergrund
- MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.
- Molekulargewicht
- 95 kDa (MW of target protein)
-