MAP4K5 Antikörper (Middle Region)

Produktnummer ABIN634353

Produktdetails anti-MAP4K5 Antikörper

Target: MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP4K5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAP4 K5 antibody was raised against the middle region of MAP4 5

Aufreinigung: Affinity purified

Immunogen: MAP4 K5 antibody was raised using the middle region of MAP4 5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP4K5 Blocking Peptide, catalog no. 33R-7562, is also available for use as a blocking control in assays to test for specificity of this MAP4K5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP4K5

Target: MAP4K5 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 5 (MAP4K5))

Andere Bezeichnung: MAP4K5 (MAP4K5 Produkte)

Synonyme: GCKR antikoerper, KHS antikoerper, KHS1 antikoerper, MAPKKKK5 antikoerper, 4432415E19Rik antikoerper, RGD1562028 antikoerper, fl74c10 antikoerper, wu:fl74c10 antikoerper, zgc:55719 antikoerper, zgc:55985 antikoerper, mitogen-activated protein kinase kinase kinase kinase 5 antikoerper, mitogen-activated protein kinase kinase kinase kinase 5 S homeolog antikoerper, MAP4K5 antikoerper, Map4k5 antikoerper, map4k5 antikoerper, map4k5.S antikoerper

Hintergrund: MAP4K5 may play a role in the response to environmental stress. Appears to act upstream of the JUN N-terminal pathway.

Molekulargewicht: 95 kDa (MW of target protein)