CRLF1 Antikörper (Middle Region)
-
- Target Alle CRLF1 Antikörper anzeigen
- CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRLF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CRLF1 antibody was raised against the middle region of CRLF1
- Aufreinigung
- Affinity purified
- Immunogen
- CRLF1 antibody was raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL
- Top Product
- Discover our top product CRLF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CRLF1 Blocking Peptide, catalog no. 33R-7646, is also available for use as a blocking control in assays to test for specificity of this CRLF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRLF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))
- Andere Bezeichnung
- CRLF1 (CRLF1 Produkte)
- Hintergrund
- CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development. Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.
- Molekulargewicht
- 46 kDa (MW of target protein)
-