CRLF1 Antikörper (Middle Region)

Produktnummer ABIN634310

Produktdetails anti-CRLF1 Antikörper

Target: CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRLF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CRLF1 antibody was raised against the middle region of CRLF1

Aufreinigung: Affinity purified

Immunogen: CRLF1 antibody was raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRLF1 Blocking Peptide, catalog no. 33R-7646, is also available for use as a blocking control in assays to test for specificity of this CRLF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRLF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRLF1

Target: CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))

Andere Bezeichnung: CRLF1 (CRLF1 Produkte)

Hintergrund: CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development. Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.

Molekulargewicht: 46 kDa (MW of target protein)