KIF15 Antikörper (Middle Region)
-
- Target Alle KIF15 Antikörper anzeigen
- KIF15 (Kinesin Family Member 15 (KIF15))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KIF15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KIF15 antibody was raised against the middle region of KIF15
- Aufreinigung
- Affinity purified
- Immunogen
- KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL
- Top Product
- Discover our top product KIF15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KIF15 Blocking Peptide, catalog no. 33R-8556, is also available for use as a blocking control in assays to test for specificity of this KIF15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF15 (Kinesin Family Member 15 (KIF15))
- Andere Bezeichnung
- KIF15 (KIF15 Produkte)
- Synonyme
- XKlp2 antikoerper, kif15 antikoerper, klp2 antikoerper, KIF15 antikoerper, si:dkey-108k21.1 antikoerper, wu:fb96c12 antikoerper, wu:fc51g12 antikoerper, wu:fe01e02 antikoerper, HKLP2 antikoerper, KNSL7 antikoerper, NY-BR-62 antikoerper, 3110023M17Rik antikoerper, 3930402I10Rik antikoerper, D330038N01 antikoerper, Knsl7 antikoerper, b2b1117.1Clo antikoerper, kinesin family member 15 L homeolog antikoerper, kinesin family member 15 antikoerper, kinesin family member 15 S homeolog antikoerper, zinc finger protein 660 antikoerper, kif15.L antikoerper, KIF15 antikoerper, kif15.S antikoerper, kif15 antikoerper, Kif15 antikoerper, ZNF660 antikoerper
- Hintergrund
- KIF15 is the plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly.
- Molekulargewicht
- 160 kDa (MW of target protein)
-