Cyclin Y Antikörper (Middle Region)

Produktnummer ABIN634074

Produktdetails anti-Cyclin Y Antikörper

Target: Cyclin Y (CCNY)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cyclin Y Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cyclin Y antibody was raised against the middle region of CCNY

Aufreinigung: Affinity purified

Immunogen: Cyclin Y antibody was raised using the middle region of CCNY corresponding to a region with amino acids DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cyclin Y Blocking Peptide, catalog no. 33R-1914, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cyclin Y

Target: Cyclin Y (CCNY)

Andere Bezeichnung: Cyclin Y (CCNY Produkte)

Synonyme: CG14939 antikoerper, Dcyclin Y antikoerper, Dmel\\CG14939 antikoerper, anon-WO0118547.165 antikoerper, i182 antikoerper, C10orf9 antikoerper, CBCP1 antikoerper, CCNX antikoerper, CFP1 antikoerper, 1700025H17Rik antikoerper, 3110050L10Rik antikoerper, 4631402G10Rik antikoerper, 5730405I09Rik antikoerper, RGD1565969 antikoerper, cyclin Y antikoerper, Cyclin Y antikoerper, cyclin Y like 1 antikoerper, CCNY antikoerper, CycY antikoerper, Ccny antikoerper, CCNYL1 antikoerper

Hintergrund: CCNY belongs to the cyclin family, Cyclin Y subfamily. It contains 1 cyclin N-terminal domain. Single nucleotide polymorphism in CCNY gene is associated with Crohn's disease and ulcerative colitis.

Molekulargewicht: 39 kDa (MW of target protein)