Cyclin Y Antikörper (Middle Region)
-
- Target Alle Cyclin Y (CCNY) Antikörper anzeigen
- Cyclin Y (CCNY)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cyclin Y Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cyclin Y antibody was raised against the middle region of CCNY
- Aufreinigung
- Affinity purified
- Immunogen
- Cyclin Y antibody was raised using the middle region of CCNY corresponding to a region with amino acids DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY
- Top Product
- Discover our top product CCNY Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cyclin Y Blocking Peptide, catalog no. 33R-1914, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNY antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cyclin Y (CCNY)
- Andere Bezeichnung
- Cyclin Y (CCNY Produkte)
- Synonyme
- CG14939 antikoerper, Dcyclin Y antikoerper, Dmel\\CG14939 antikoerper, anon-WO0118547.165 antikoerper, i182 antikoerper, C10orf9 antikoerper, CBCP1 antikoerper, CCNX antikoerper, CFP1 antikoerper, 1700025H17Rik antikoerper, 3110050L10Rik antikoerper, 4631402G10Rik antikoerper, 5730405I09Rik antikoerper, RGD1565969 antikoerper, cyclin Y antikoerper, Cyclin Y antikoerper, cyclin Y like 1 antikoerper, CCNY antikoerper, CycY antikoerper, Ccny antikoerper, CCNYL1 antikoerper
- Hintergrund
- CCNY belongs to the cyclin family, Cyclin Y subfamily. It contains 1 cyclin N-terminal domain. Single nucleotide polymorphism in CCNY gene is associated with Crohn's disease and ulcerative colitis.
- Molekulargewicht
- 39 kDa (MW of target protein)
-