Haptoglobin Antikörper (Middle Region)

Produktnummer ABIN633992

Der Kaninchen Polyklonal anti-Haptoglobin Antikörper wird verwendet zum Nachweis von Haptoglobin in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Haptoglobin Antikörper (Middle Region) (ABIN633992)

Target: Haptoglobin (HP)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Haptoglobin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Haptoglobin Antikörper

Bindungsspezifität: Middle Region

Spezifität: Haptoglobin antibody was raised against the middle region of HP

Aufreinigung: Affinity purified

Immunogen: Haptoglobin antibody was raised using the middle region of HP corresponding to a region with amino acids NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNE

Anwendungsinformationen

Applikationshinweise: WB: 0.0125 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Haptoglobin Blocking Peptide, (ABIN5613926), is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Haptoglobin

Target: Haptoglobin (HP)

Andere Bezeichnung: Haptoglobin

Hintergrund: This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis