ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN633811, Anbieter: Anmelden zum Anzeigen
Antigen
  • SIAT8D
  • PST
  • PST1
  • ST8SIA-IV
  • ST8Sia-IV
  • PST-1
  • SIAT8-D
  • ST8SiaIV
  • Siat8d
  • AI266890
  • ST1A1
  • Stp
  • Stp1
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  • sulfotransferase family 1A, phenol-preferring, member 1
  • ST8SIA4
  • St8sia4
  • Sult1a1
Epitop
Middle Region
10
9
9
7
4
2
2
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
31
17
8
5
4
4
4
4
4
3
2
2
2
1
1
1
Wirt
Kaninchen
33
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
34
24
16
16
4
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Immunogen ST8 SIA4 antibody was raised using the middle region of ST8 IA4 corresponding to a region with amino acids DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM
Spezifität ST8 SIA4 antibody was raised against the middle region of ST8 IA4
Reinigung Affinity purified
Andere Bezeichnung ST8SIA4 (ST8SIA4 Antibody Abstract)
Hintergrund ST8SIA4 catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). ST8SIA4, a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus.
Molekulargewicht 41 kDa (MW of target protein)
Forschungsgebiet Signaling
Applikationshinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ST8SIA4 Blocking Peptide, catalog no. 33R-2214, is also available for use as a blocking control in assays to test for specificity of this ST8SIA4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Western Blotting (WB) image for anti-ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4) (Middle Region) Antikörper (ABIN633811) ST8SIA4 antibody used at 1 ug/ml to detect target protein.
Haben Sie etwas anderes gesucht?