ST8SIA4 Antikörper (Middle Region)

Produktnummer ABIN633811

Produktdetails anti-ST8SIA4 Antikörper

Target: ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST8SIA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ST8 SIA4 antibody was raised against the middle region of ST8 IA4

Aufreinigung: Affinity purified

Immunogen: ST8 SIA4 antibody was raised using the middle region of ST8 IA4 corresponding to a region with amino acids DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST8SIA4 Blocking Peptide, catalog no. 33R-2214, is also available for use as a blocking control in assays to test for specificity of this ST8SIA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST8SIA4

Target: ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))

Andere Bezeichnung: ST8SIA4 (ST8SIA4 Produkte)

Synonyme: PST antikoerper, PST-1 antikoerper, SIAT8-D antikoerper, ST8SiaIV antikoerper, Siat8d antikoerper, PST1 antikoerper, SIAT8D antikoerper, ST8SIA-IV antikoerper, ST8Sia-IV antikoerper, pst antikoerper, siat 8D antikoerper, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 antikoerper, St8sia4 antikoerper, ST8SIA4 antikoerper, st8sia4 antikoerper

Hintergrund: ST8SIA4 catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). ST8SIA4, a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus.

Molekulargewicht: 41 kDa (MW of target protein)