KCNK15 Antikörper (Middle Region)

Produktnummer ABIN633795

Produktdetails anti-KCNK15 Antikörper

Target: KCNK15 (Potassium Channel Subfamily K Member 15 (KCNK15))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNK15 antibody was raised against the middle region of KCNK15

Aufreinigung: Affinity purified

Immunogen: KCNK15 antibody was raised using the middle region of KCNK15 corresponding to a region with amino acids ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK15 Blocking Peptide, catalog no. 33R-1496, is also available for use as a blocking control in assays to test for specificity of this KCNK15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK15

Target: KCNK15 (Potassium Channel Subfamily K Member 15 (KCNK15))

Andere Bezeichnung: KCNK15 (KCNK15 Produkte)

Synonyme: zgc:171568 antikoerper, K2p15.1 antikoerper, KCNK11 antikoerper, KCNK14 antikoerper, KT3.3 antikoerper, TASK-5 antikoerper, TASK5 antikoerper, dJ781B1.1 antikoerper, potassium two pore domain channel subfamily K member 15 antikoerper, potassium channel, subfamily K, member 15 antikoerper, Potassium channel subfamily K member 15 antikoerper, KCNK15 antikoerper, kcnk15 antikoerper, kcnkf antikoerper, Kcnk15 antikoerper

Hintergrund: KCNK15 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK15 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Molekulargewicht: 36 kDa (MW of target protein)