In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Sodium Channel, Voltage-Gated, Type I, beta (SCN1B) Antikörper

Antigen

Sodium Channel, Voltage-Gated, Type I, beta (SCN1B)

Synonyme GEFSP1
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN633779
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung SCN1B
Immunogen SCN1B antibody was raised using the middle region of SCN1B corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS
Beschreibung Voltage-gated sodium channels are essential for the generation and propagation of action potentials in striated muscle and neuronal tissues. Biochemically, they consist of a large alpha subunit and 1 or 2 smaller beta subunits, such as SCN1B. The alpha subunit alone can exhibit all the functional attributes of a voltage-gated Na+ channel, but requires a beta-1 subunit for normal inactivation kinetics.
Molekulargewicht 25 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCN1B antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Signaltransduktion, Metabolismus

Alternativen

Alternativen zu Antigen "Sodium Channel, Voltage-Gated, Type I, beta (SCN1B)", Typ "Antikörper" finden
Wirte Kaninchen (26)
Reaktivitäten Human (26), Maus (23), Ratte (Rattus) (23), Rind (Kuh) (3), Hund (3), Pferd (2), Schwein (2), Kaninchen (1)
Applikationen Durchflusszytometrie (FACS) (18), Immunfluoreszenz (IF) (18), Western Blot (WB) (9), ELISA (4), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (2), Immunhistochemie (Paraffinschnitte) (IHC (p)) (2), Immunpräzipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
Konjugate Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)