KCNK9 Antikörper (N-Term)

Produktnummer ABIN633772

Produktdetails anti-KCNK9 Antikörper

Target: KCNK9 (Potassium Channel, Subfamily K, Member 9 (KCNK9))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNK9 antibody was raised against the N terminal of KCNK9

Aufreinigung: Affinity purified

Immunogen: KCNK9 antibody was raised using the N terminal of KCNK9 corresponding to a region with amino acids REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK9 Blocking Peptide, catalog no. 33R-7869, is also available for use as a blocking control in assays to test for specificity of this KCNK9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK9

Target: KCNK9 (Potassium Channel, Subfamily K, Member 9 (KCNK9))

Andere Bezeichnung: KCNK9 (KCNK9 Produkte)

Synonyme: Task3 antikoerper, K2p9.1 antikoerper, KT3.2 antikoerper, TASK-3 antikoerper, TASK3 antikoerper, KCNK9 antikoerper, LOC799704 antikoerper, Kcnk9 antikoerper, task3 antikoerper, k2p9.1 antikoerper, task-3 antikoerper, kt3.2 antikoerper, potassium channel, subfamily K, member 9 antikoerper, potassium two pore domain channel subfamily K member 9 antikoerper, potassium channel, two pore domain subfamily K, member 9 antikoerper, potassium channel, two pore domain subfamily K, member 9 L homeolog antikoerper, Kcnk9 antikoerper, KCNK9 antikoerper, kcnk9 antikoerper, kcnk9.L antikoerper

Hintergrund: KCNK9 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This open channel is highly expressed in the cerebellum. It is inhibited by extracellular acidification and arachidonic acid, and strongly inhibited by phorbol 12-myristate 13-acetate.

Molekulargewicht: 42 kDa (MW of target protein)