TPCN1 Antikörper (N-Term)

Produktnummer ABIN633731

Produktdetails anti-TPCN1 Antikörper

Target: TPCN1 (Two Pore Segment Channel 1 (TPCN1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPCN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TPCN1 antibody was raised against the N terminal of TPCN1

Aufreinigung: Affinity purified

Immunogen: TPCN1 antibody was raised using the N terminal of TPCN1 corresponding to a region with amino acids YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TPCN1 Blocking Peptide, catalog no. 33R-10210, is also available for use as a blocking control in assays to test for specificity of this TPCN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPCN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPCN1

Target: TPCN1 (Two Pore Segment Channel 1 (TPCN1))

Andere Bezeichnung: TPCN1 (TPCN1 Produkte)

Synonyme: ATCCH1 antikoerper, ATTPC1 antikoerper, CALCIUM CHANNEL 1 antikoerper, FATTY ACID OXYGENATION UPREGULATED 2 antikoerper, FOU2 antikoerper, T5L23.5 antikoerper, two-pore channel 1 antikoerper, 5730403B01Rik antikoerper, Tpc1 antikoerper, mKIAA1169 antikoerper, TPC1 antikoerper, si:dkey-125i10.5 antikoerper, two pore segment channel 1 antikoerper, two-pore channel 1 antikoerper, two pore channel 1 antikoerper, Tpcn1 antikoerper, TPC1 antikoerper, TPCN1 antikoerper, tpcn1 antikoerper

Hintergrund: TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6.

Molekulargewicht: 94 kDa (MW of target protein)