KCNK12 Antikörper (Middle Region)

Produktnummer ABIN633703

Produktdetails anti-KCNK12 Antikörper

Target: KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNK12 antibody was raised against the middle region of KCNK12

Aufreinigung: Affinity purified

Immunogen: KCNK12 antibody was raised using the middle region of KCNK12 corresponding to a region with amino acids EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK12 Blocking Peptide, catalog no. 33R-2445, is also available for use as a blocking control in assays to test for specificity of this KCNK12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK12

Target: KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))

Andere Bezeichnung: KCNK12 (KCNK12 Produkte)

Synonyme: KCNK12 antikoerper, K2p12.1 antikoerper, THIK-2 antikoerper, THIK2 antikoerper, mntk1 antikoerper, potassium two pore domain channel subfamily K member 12 antikoerper, potassium channel, subfamily K, member 12 antikoerper, KCNK12 antikoerper, Kcnk12 antikoerper

Hintergrund: KCNK12 is a member of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK12 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Molekulargewicht: 47 kDa (MW of target protein)