KCNA7 Antikörper (C-Term)
-
- Target Alle KCNA7 Antikörper anzeigen
- KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNA7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNA7 antibody was raised against the C terminal of KCNA7
- Aufreinigung
- Affinity purified
- Immunogen
- KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV
- Top Product
- Discover our top product KCNA7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNA7 Blocking Peptide, catalog no. 33R-3222, is also available for use as a blocking control in assays to test for specificity of this KCNA7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))
- Andere Bezeichnung
- KCNA7 (KCNA7 Produkte)
- Synonyme
- hak6 antikoerper, kv1.7 antikoerper, XKv1.10 antikoerper, kvl10-A antikoerper, HAK6 antikoerper, KV1.7 antikoerper, Kv1.7 antikoerper, potassium channel, voltage gated shaker related subfamily A, member 7 S homeolog antikoerper, potassium voltage-gated channel subfamily A member 7 antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 7 antikoerper, kcna7.S antikoerper, KCNA7 antikoerper, Kcna7 antikoerper
- Hintergrund
- Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.
- Molekulargewicht
- 50 kDa (MW of target protein)
-