KCNA7 Antikörper (C-Term)

Produktnummer ABIN633690

Produktdetails anti-KCNA7 Antikörper

Target: KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNA7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KCNA7 antibody was raised against the C terminal of KCNA7

Aufreinigung: Affinity purified

Immunogen: KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNA7 Blocking Peptide, catalog no. 33R-3222, is also available for use as a blocking control in assays to test for specificity of this KCNA7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNA7

Target: KCNA7 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 7 (KCNA7))

Andere Bezeichnung: KCNA7 (KCNA7 Produkte)

Synonyme: hak6 antikoerper, kv1.7 antikoerper, XKv1.10 antikoerper, kvl10-A antikoerper, HAK6 antikoerper, KV1.7 antikoerper, Kv1.7 antikoerper, potassium channel, voltage gated shaker related subfamily A, member 7 S homeolog antikoerper, potassium voltage-gated channel subfamily A member 7 antikoerper, potassium voltage-gated channel, shaker-related subfamily, member 7 antikoerper, kcna7.S antikoerper, KCNA7 antikoerper, Kcna7 antikoerper

Hintergrund: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.

Molekulargewicht: 50 kDa (MW of target protein)