RPS7 Antikörper (Middle Region)

Produktnummer ABIN633563

Produktdetails anti-RPS7 Antikörper

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS7 antibody was raised against the middle region of RPS7

Aufreinigung: Affinity purified

Immunogen: RPS7 antibody was raised using the middle region of RPS7 corresponding to a region with amino acids RIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS7 Blocking Peptide, catalog no. 33R-7979, is also available for use as a blocking control in assays to test for specificity of this RPS7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS7

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Andere Bezeichnung: RPS7 (RPS7 Produkte)

Synonyme: CG1883 antikoerper, Dmel\\CG1883 antikoerper, DBA8 antikoerper, S7 antikoerper, Mtu antikoerper, Rps7A antikoerper, zgc:73216 antikoerper, dba8 antikoerper, rpS8B antikoerper, rpS8A antikoerper, Ribosomal protein S7 antikoerper, 30S ribosomal protein S7 antikoerper, 40S ribosomal protein S7 antikoerper, ribosomal protein S7 antikoerper, ribosomal protein S7 S homeolog antikoerper, ribosomal protein S8 antikoerper, RpS7 antikoerper, rps7 antikoerper, rps-7 antikoerper, RPS7 antikoerper, Rps7 antikoerper, rps7.S antikoerper

Hintergrund: RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Tube Formation