DAZ4 Antikörper (Middle Region)
-
- Target Alle DAZ4 Antikörper anzeigen
- DAZ4 (Deleted In Azoospermia 4 (DAZ4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DAZ4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DAZ4 antibody was raised against the middle region of DAZ4
- Aufreinigung
- Affinity purified
- Immunogen
- DAZ4 antibody was raised using the middle region of DAZ4 corresponding to a region with amino acids ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA
- Top Product
- Discover our top product DAZ4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DAZ4 Blocking Peptide, catalog no. 33R-4176, is also available for use as a blocking control in assays to test for specificity of this DAZ4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAZ4 (Deleted In Azoospermia 4 (DAZ4))
- Andere Bezeichnung
- DAZ4 (DAZ4 Produkte)
- Synonyme
- pDP1680 antikoerper, pDP1681 antikoerper, DAZ4 antikoerper, deleted in azoospermia 4 antikoerper, DAZ4 antikoerper
- Hintergrund
- This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.
- Molekulargewicht
- 44 kDa (MW of target protein)
-