DAZ4 Antikörper (Middle Region)

Produktnummer ABIN633467

Produktdetails anti-DAZ4 Antikörper

Target: DAZ4 (Deleted In Azoospermia 4 (DAZ4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAZ4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DAZ4 antibody was raised against the middle region of DAZ4

Aufreinigung: Affinity purified

Immunogen: DAZ4 antibody was raised using the middle region of DAZ4 corresponding to a region with amino acids ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAZ4 Blocking Peptide, catalog no. 33R-4176, is also available for use as a blocking control in assays to test for specificity of this DAZ4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAZ4

Target: DAZ4 (Deleted In Azoospermia 4 (DAZ4))

Andere Bezeichnung: DAZ4 (DAZ4 Produkte)

Synonyme: pDP1680 antikoerper, pDP1681 antikoerper, DAZ4 antikoerper, deleted in azoospermia 4 antikoerper, DAZ4 antikoerper

Hintergrund: This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.

Molekulargewicht: 44 kDa (MW of target protein)