LARP6 Antikörper (Middle Region)
-
- Target Alle LARP6 Antikörper anzeigen
- LARP6 (La Ribonucleoprotein Domain Family, Member 6 (LARP6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LARP6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LARP6 antibody was raised against the middle region of LARP6
- Aufreinigung
- Affinity purified
- Immunogen
- LARP6 antibody was raised using the middle region of LARP6 corresponding to a region with amino acids MGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC
- Top Product
- Discover our top product LARP6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LARP6 Blocking Peptide, catalog no. 33R-6082, is also available for use as a blocking control in assays to test for specificity of this LARP6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LARP6 (La Ribonucleoprotein Domain Family, Member 6 (LARP6))
- Andere Bezeichnung
- LARP6 (LARP6 Produkte)
- Synonyme
- im:7142825 antikoerper, wu:fa55b04 antikoerper, ACHN antikoerper, 5430431G03Rik antikoerper, AI552438 antikoerper, Achn antikoerper, RGD1308414 antikoerper, La ribonucleoprotein domain family, member 6b antikoerper, La ribonucleoprotein domain family member 6 antikoerper, La ribonucleoprotein domain family, member 6 antikoerper, larp6b antikoerper, LARP6 antikoerper, Larp6 antikoerper
- Hintergrund
- The function of LARP6 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 55 kDa (MW of target protein)
-