EIF2D Antikörper (Middle Region)

Produktnummer ABIN633404

Produktdetails anti-EIF2D Antikörper

Target: EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF2D Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ligatin antibody was raised against the middle region of LGTN

Aufreinigung: Affinity purified

Immunogen: Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ligatin Blocking Peptide, catalog no. 33R-4725, is also available for use as a blocking control in assays to test for specificity of this Ligatin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGTN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF2D

Target: EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))

Andere Bezeichnung: Ligatin (EIF2D Produkte)

Synonyme: LGTN antikoerper, HCA56 antikoerper, D1Ertd5e antikoerper, Lgtn antikoerper, eukaryotic translation initiation factor 2D antikoerper, EIF2D antikoerper, Eif2d antikoerper

Hintergrund: LGTN is a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively.

Molekulargewicht: 65 kDa (MW of target protein)