RPS7 Antikörper (N-Term)

Produktnummer ABIN633403

Produktdetails anti-RPS7 Antikörper

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS7 antibody was raised against the N terminal of RPS7

Aufreinigung: Affinity purified

Immunogen: RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS7 Blocking Peptide, catalog no. 33R-6006, is also available for use as a blocking control in assays to test for specificity of this RPS7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS7

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Andere Bezeichnung: RPS7 (RPS7 Produkte)

Synonyme: CG1883 antikoerper, Dmel\\CG1883 antikoerper, DBA8 antikoerper, S7 antikoerper, Mtu antikoerper, Rps7A antikoerper, zgc:73216 antikoerper, dba8 antikoerper, rpS8B antikoerper, rpS8A antikoerper, Ribosomal protein S7 antikoerper, 30S ribosomal protein S7 antikoerper, 40S ribosomal protein S7 antikoerper, ribosomal protein S7 antikoerper, ribosomal protein S7 S homeolog antikoerper, ribosomal protein S8 antikoerper, RpS7 antikoerper, rps7 antikoerper, rps-7 antikoerper, RPS7 antikoerper, Rps7 antikoerper, rps7.S antikoerper

Hintergrund: RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Tube Formation