INTS6 Antikörper (C-Term)

Produktnummer ABIN633264

Produktdetails anti-INTS6 Antikörper

Target: INTS6 (Integrator Complex Subunit 6 (INTS6))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser INTS6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: INTS6 antibody was raised against the C terminal of INTS6

Aufreinigung: Affinity purified

Immunogen: INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

INTS6 Blocking Peptide, catalog no. 33R-3261, is also available for use as a blocking control in assays to test for specificity of this INTS6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INTS6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu INTS6

Target: INTS6 (Integrator Complex Subunit 6 (INTS6))

Andere Bezeichnung: INTS6 (INTS6 Produkte)

Synonyme: DBI-1 antikoerper, DDX26 antikoerper, DDX26A antikoerper, DICE1 antikoerper, HDB antikoerper, INT6 antikoerper, Notchl2 antikoerper, EIF3-P48 antikoerper, EIF3S6 antikoerper, eIF3-p46 antikoerper, 2900075H24Rik antikoerper, AI480962 antikoerper, Ddx26 antikoerper, Notch2l antikoerper, LRRGT00024 antikoerper, ints6 antikoerper, zgc:63527 antikoerper, INTS6 antikoerper, ints6-b antikoerper, Int6-A antikoerper, dbi-1 antikoerper, ddx26 antikoerper, ddx26a antikoerper, dice1 antikoerper, hdb antikoerper, int6 antikoerper, ints6-a antikoerper, notchl2 antikoerper, integrator complex subunit 6 antikoerper, eukaryotic translation initiation factor 3 subunit E antikoerper, integrator complex subunit 6 like antikoerper, integrator complex subunit 6 S homeolog antikoerper, integrator complex subunit 6 L homeolog antikoerper, INTS6 antikoerper, EIF3E antikoerper, Ints6 antikoerper, ints6l antikoerper, ints6 antikoerper, ints6.S antikoerper, Tsp_09465 antikoerper, LOC100164318 antikoerper, ints6.L antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. INTS6 is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH).

Molekulargewicht: 99 kDa (MW of target protein)