CPSF4 Antikörper (C-Term)

Produktnummer ABIN633192

Produktdetails anti-CPSF4 Antikörper

Target: CPSF4 (Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPSF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CPSF4 antibody was raised against the C terminal of CPSF4

Aufreinigung: Affinity purified

Immunogen: CPSF4 antibody was raised using the C terminal of CPSF4 corresponding to a region with amino acids SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPSF4 Blocking Peptide, catalog no. 33R-8599, is also available for use as a blocking control in assays to test for specificity of this CPSF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPSF4

Target: CPSF4 (Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4))

Andere Bezeichnung: CPSF4 (CPSF4 Produkte)

Synonyme: cpsf30 antikoerper, nar antikoerper, neb1 antikoerper, 30kDa antikoerper, C79664 antikoerper, CPSF30 antikoerper, NAR antikoerper, NEB1 antikoerper, cleavage and polyadenylation specific factor 4 antikoerper, cleavage and polyadenylation specific factor 4, 30kDa antikoerper, cleavage and polyadenylation specific factor 4 S homeolog antikoerper, CPSF4 antikoerper, Cpsf4 antikoerper, LOC733099 antikoerper, LOC100360200 antikoerper, cpsf4.S antikoerper, cpsf4 antikoerper

Hintergrund: Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30 kDa subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs.

Molekulargewicht: 24 kDa (MW of target protein)