ADAMTS18 Antikörper (N-Term)
-
- Target Alle ADAMTS18 Antikörper anzeigen
- ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAMTS18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ADAMTS18 antibody was raised against the N terminal of ADAMTS18
- Aufreinigung
- Affinity purified
- Immunogen
- ADAMTS18 antibody was raised using the N terminal of ADAMTS18 corresponding to a region with amino acids FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS
- Top Product
- Discover our top product ADAMTS18 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADAMTS18 Blocking Peptide, catalog no. 33R-3140, is also available for use as a blocking control in assays to test for specificity of this ADAMTS18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMTS18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAMTS18 (ADAM Metallopeptidase with thrombospondin Type 1 Motif, 18 (ADAMTS18))
- Andere Bezeichnung
- ADAMTS18 (ADAMTS18 Produkte)
- Synonyme
- 9630038L21 antikoerper, ADAMTS21 antikoerper, E130314N14Rik antikoerper, KNO2 antikoerper, RGD1560118 antikoerper, a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 18 antikoerper, ADAM metallopeptidase with thrombospondin type 1 motif 18 antikoerper, ADAM metallopeptidase with thrombospondin type 1 motif, 18 antikoerper, Adamts18 antikoerper, ADAMTS18 antikoerper
- Hintergrund
- ADAMTS18 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains.
- Molekulargewicht
- 104 kDa (MW of target protein)
-