DOK6 Antikörper (Middle Region)

Produktnummer ABIN633168

Produktdetails anti-DOK6 Antikörper

Target: DOK6 (Docking Protein 6 (DOK6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DOK6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DOK6 antibody was raised against the middle region of DOK6

Aufreinigung: Affinity purified

Immunogen: DOK6 antibody was raised using the middle region of DOK6 corresponding to a region with amino acids IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DOK6 Blocking Peptide, catalog no. 33R-4227, is also available for use as a blocking control in assays to test for specificity of this DOK6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DOK6

Target: DOK6 (Docking Protein 6 (DOK6))

Andere Bezeichnung: DOK6 (DOK6 Produkte)

Synonyme: DOK5L antikoerper, HsT3226 antikoerper, Dok-6 antikoerper, RGD1564376 antikoerper, docking protein 6 antikoerper, DOK6 antikoerper, Dok6 antikoerper

Hintergrund: DOK6 is a member of the DOK family of intracellular adaptors that play a role in the RET signaling cascade.

Molekulargewicht: 38 kDa (MW of target protein)