RHOJ Antikörper (Middle Region)
-
- Target Alle RHOJ Antikörper anzeigen
- RHOJ (Ras Homolog Gene Family, Member J (RHOJ))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RHOJ Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RHOJ antibody was raised against the middle region of RHOJ
- Aufreinigung
- Affinity purified
- Immunogen
- RHOJ antibody was raised using the middle region of RHOJ corresponding to a region with amino acids LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK
- Top Product
- Discover our top product RHOJ Primärantikörper
-
anti-Ras Homolog Gene Family, Member J (RHOJ) antibody
RHOJ Reaktivität: Human WB, IHC, IHC (p), IF Wirt: Maus Monoclonal 2C9 unconjugated
anti-Ras Homolog Gene Family, Member J (RHOJ) (AA 1-214) antibodyRHOJ Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 1E4 unconjugated
anti-Ras Homolog Gene Family, Member J (RHOJ) (AA 131-159) antibodyRHOJ Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB31757 unconjugated
anti-Ras Homolog Gene Family, Member J (RHOJ) (AA 1-211) antibodyRHOJ Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ras Homolog Gene Family, Member J (RHOJ) (AA 71-120) antibodyRHOJ Reaktivität: Human, Maus, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Ratte, Zebrafisch (Danio rerio), Fledermaus, Huhn, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ras Homolog Gene Family, Member J (RHOJ) (Middle Region) antibodyRHOJ Reaktivität: Human, Maus, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Ratte, Zebrafisch (Danio rerio), Saccharomyces cerevisiae WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ras Homolog Gene Family, Member J (RHOJ) (Middle Region) antibodyRHOJ Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RHOJ Blocking Peptide, catalog no. 33R-4988, is also available for use as a blocking control in assays to test for specificity of this RHOJ antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOJ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHOJ (Ras Homolog Gene Family, Member J (RHOJ))
- Andere Bezeichnung
- RHOJ (RHOJ Produkte)
- Synonyme
- MGC83410 antikoerper, RHOJ antikoerper, si:dkey-100h21.1 antikoerper, arhj antikoerper, rasl7b antikoerper, tc10b antikoerper, ARHJ antikoerper, RASL7B antikoerper, TC10B antikoerper, TCL antikoerper, 1110005O19Rik antikoerper, AW210585 antikoerper, Arhj antikoerper, TC10L antikoerper, ras homolog family member J antikoerper, ras homolog family member J L homeolog antikoerper, RHOJ antikoerper, rhoj.L antikoerper, rhoj antikoerper, Rhoj antikoerper
- Hintergrund
- ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.
- Molekulargewicht
- 24 kDa (MW of target protein)
-
