TINAG Antikörper (Middle Region)
-
- Target Alle TINAG Antikörper anzeigen
- TINAG (Tubulointerstitial Nephritis Antigen (TINAG))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TINAG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TINAG antibody was raised against the middle region of TINAG
- Aufreinigung
- Affinity purified
- Immunogen
- TINAG antibody was raised using the middle region of TINAG corresponding to a region with amino acids VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG
- Top Product
- Discover our top product TINAG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TINAG Blocking Peptide, catalog no. 33R-9407, is also available for use as a blocking control in assays to test for specificity of this TINAG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINAG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TINAG (Tubulointerstitial Nephritis Antigen (TINAG))
- Andere Bezeichnung
- TINAG (TINAG Produkte)
- Synonyme
- TIN-AG antikoerper, AI452335 antikoerper, TIN-ag antikoerper, tubulointerstitial nephritis antigen antikoerper, TINAG antikoerper, Tinag antikoerper
- Hintergrund
- TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.
- Molekulargewicht
- 54 kDa (MW of target protein)
-