IPP Antikörper (C-Term)

Produktnummer ABIN632969

Produktdetails anti-IPP Antikörper

Target: IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IPP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IPP antibody was raised against the C terminal of IPP

Aufreinigung: Affinity purified

Immunogen: IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IPP Blocking Peptide, catalog no. 33R-2592, is also available for use as a blocking control in assays to test for specificity of this IPP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IPP

Target: IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))

Andere Bezeichnung: IPP (IPP Produkte)

Synonyme: KLHL27 antikoerper, D4Jhu8 antikoerper, Mipp antikoerper, klhl27 antikoerper, MGC80773 antikoerper, MGC136076 antikoerper, zgc:171487 antikoerper, intracisternal A particle-promoted polypeptide antikoerper, IAP promoted placental gene antikoerper, intracisternal A particle-promoted polypeptide L homeolog antikoerper, IPP antikoerper, Ipp antikoerper, ipp.L antikoerper, ipp antikoerper

Hintergrund: IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.

Molekulargewicht: 65 kDa (MW of target protein)