TASP1 Antikörper (Middle Region)

Produktnummer ABIN632927

Produktdetails anti-TASP1 Antikörper

Target: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TASP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TASP1 antibody was raised against the middle region of TASP1

Aufreinigung: Affinity purified

Immunogen: TASP1 antibody was raised using the middle region of TASP1 corresponding to a region with amino acids QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TASP1 Blocking Peptide, catalog no. 33R-7663, is also available for use as a blocking control in assays to test for specificity of this TASP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TASP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TASP1

Target: TASP1 (Taspase, Threonine Aspartase, 1 (TASP1))

Andere Bezeichnung: TASP1 (TASP1 Produkte)

Synonyme: 4930485D02Rik antikoerper, AW986064 antikoerper, RGD1308591 antikoerper, C20orf13 antikoerper, dJ585I14.2 antikoerper, taspase, threonine aspartase 1 antikoerper, taspase 1 antikoerper, Tasp1 antikoerper, TASP1 antikoerper

Hintergrund: This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits.

Molekulargewicht: 19 kDa (MW of target protein)