PEPD Antikörper (Middle Region)

Produktnummer ABIN632867

Produktdetails anti-PEPD Antikörper

Target: PEPD (Peptidase D (PEPD))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEPD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Peptidase D antibody was raised against the middle region of PEPD

Aufreinigung: Affinity purified

Immunogen: Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Peptidase D Blocking Peptide, catalog no. 33R-4964, is also available for use as a blocking control in assays to test for specificity of this Peptidase D antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEPD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEPD

Target: PEPD (Peptidase D (PEPD))

Andere Bezeichnung: Peptidase D (PEPD Produkte)

Synonyme: MGC89151 antikoerper, DDBDRAFT_0190220 antikoerper, DDBDRAFT_0266378 antikoerper, DDB_0190220 antikoerper, DDB_0266378 antikoerper, PROLIDASE antikoerper, cb1000 antikoerper, fj78g11 antikoerper, wu:fj78g11 antikoerper, prolidase antikoerper, Pep-4 antikoerper, Pep4 antikoerper, peptidase D antikoerper, peptidase D L homeolog antikoerper, pepd antikoerper, pepD antikoerper, PEPD antikoerper, pepd.L antikoerper, Pepd antikoerper

Hintergrund: Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.

Molekulargewicht: 54 kDa (MW of target protein)