LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A) Antikörper

Antigen: LSM14A, SCD6 Homolog A (S. Cerevisiae) (LSM14A)

Synonyme: RAP55, FAM61A, RAP55A, C19orf13, DKFZp434D1335, Tral, AA407828, AU017544, 2700023B17Rik, RGD1305695, fam61a, MGC66203, zgc:63681, zgc:66203, zgc:77302, wu:fj52e11, rap55, MGC69193, lsm14a, rap55a, xRAP55, xRAP55A, MGC82934, RAP55A-A, MGC129061, DKFZp459H1116

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN632816

Produktbeschreibung

Weitere Bezeichnung: LSM14A

Immunogen: LSM14A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI

Beschreibung: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molekulargewicht: 50 kDa (MW of target protein)

Synonyme: RAP55, FAM61A, RAP55A, C19orf13, DKFZp434D1335, Tral, AA407828, AU017544, 2700023B17Rik, RGD1305695, fam61a, MGC66203, zgc:63681, zgc:66203, zgc:77302, wu:fj52e11, rap55, MGC69193, lsm14a, rap55a, xRAP55, xRAP55A, MGC82934, RAP55A-A, MGC129061, DKFZp459H1116

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSM14A antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Immunologie, DNS/RNS