LSM14A Antikörper

Produktnummer ABIN632816

Der Kaninchen Polyklonal anti-LSM14A Antikörper wird verwendet zum Nachweis von LSM14A in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für LSM14A Antikörper (ABIN632816)

Target: LSM14A (LSM14A, SCD6 Homolog A (LSM14A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LSM14A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LSM14A Antikörper

Aufreinigung: Affinity purified

Immunogen: LSM14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LSM14A Blocking Peptide, (ABIN939891), is also available for use as a blocking control in assays to test for specificity of this LSM14A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LSM14A

Target: LSM14A (LSM14A, SCD6 Homolog A (LSM14A))

Andere Bezeichnung: LSM14A

Hintergrund: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Ribonucleoprotein Complex Subunit Organization