GALM Antikörper
-
- Target Alle GALM Antikörper anzeigen
- GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GALM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK
- Top Product
- Discover our top product GALM Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GALM Blocking Peptide, catalog no. 33R-9947, is also available for use as a blocking control in assays to test for specificity of this GALM antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALM antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))
- Andere Bezeichnung
- GALM (GALM Produkte)
- Synonyme
- GALM antikoerper, A530057M15Rik antikoerper, AU015645 antikoerper, AU020959 antikoerper, MUT antikoerper, IBD1 antikoerper, galactose mutarotase antikoerper, galactose mutarotase (aldose 1-epimerase) antikoerper, Aldose-1-epimerase (Galactose mutarotase) antikoerper, galactose mutarotase (aldose 1-epimerase) L homeolog antikoerper, GALM antikoerper, galm antikoerper, galM antikoerper, galm.L antikoerper, Ping_2018 antikoerper, BRADO1815 antikoerper, BBta_2135 antikoerper, Spro_1290 antikoerper, PC1_1264 antikoerper, Dd586_1213 antikoerper, Kvar_3617 antikoerper, AOLE_14520 antikoerper, Entcl_3074 antikoerper, Pat9b_1148 antikoerper, Rahaq_3123 antikoerper, Ccan_05570 antikoerper, Galm antikoerper
- Hintergrund
- GALM is an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. It is expressed in the cytoplasm and has a preference for galactose. The protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.
- Molekulargewicht
- 38 kDa (MW of target protein)
-