SPATA6 Antikörper (Middle Region)

Produktnummer ABIN632524

Produktdetails anti-SPATA6 Antikörper

Target: SPATA6 (Spermatogenesis Associated 6 (SPATA6))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPATA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPATA6 antibody was raised against the middle region of SPATA6

Aufreinigung: Affinity purified

Immunogen: SPATA6 antibody was raised using the middle region of SPATA6 corresponding to a region with amino acids SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPATA6 Blocking Peptide, catalog no. 33R-8715, is also available for use as a blocking control in assays to test for specificity of this SPATA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPATA6

Target: SPATA6 (Spermatogenesis Associated 6 (SPATA6))

Andere Bezeichnung: SPATA6 (SPATA6 Produkte)

Hintergrund: SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.

Molekulargewicht: 54 kDa (MW of target protein)