Actin-Like 6B Antikörper (Middle Region)

Produktnummer ABIN632472

Produktdetails anti-Actin-Like 6B Antikörper

Target: Actin-Like 6B (ACTL6B)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Actin-Like 6B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACTL6 B antibody was raised against the middle region of ACTL6

Aufreinigung: Affinity purified

Immunogen: ACTL6 B antibody was raised using the middle region of ACTL6 corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTL6B Blocking Peptide, catalog no. 33R-3319, is also available for use as a blocking control in assays to test for specificity of this ACTL6B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Actin-Like 6B

Target: Actin-Like 6B (ACTL6B)

Andere Bezeichnung: ACTL6B (ACTL6B Produkte)

Synonyme: MGC110167 antikoerper, zgc:110167 antikoerper, ACTL6 antikoerper, BAF53B antikoerper, Actl6 antikoerper, ArpNa antikoerper, Baf53b antikoerper, actin-like 6B antikoerper, actin like 6B antikoerper, actl6b antikoerper, ACTL6B antikoerper, Actl6b antikoerper

Hintergrund: The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins.

Molekulargewicht: 47 kDa (MW of target protein)