ADHFE1 Antikörper (Middle Region)
-
- Target Alle ADHFE1 Antikörper anzeigen
- ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADHFE1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ADHFE1 antibody was raised against the middle region of ADHFE1
- Aufreinigung
- Affinity purified
- Immunogen
- ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS
- Top Product
- Discover our top product ADHFE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADHFE1 Blocking Peptide, catalog no. 33R-7987, is also available for use as a blocking control in assays to test for specificity of this ADHFE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADHFE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))
- Andere Bezeichnung
- ADHFE1 (ADHFE1 Produkte)
- Synonyme
- adh-8 antikoerper, adh8 antikoerper, zgc:77479 antikoerper, ADHFE1 antikoerper, ADH8 antikoerper, HOT antikoerper, 6330565B14Rik antikoerper, AI043035 antikoerper, Adh8 antikoerper, alcohol dehydrogenase, iron containing 1 antikoerper, alcohol dehydrogenase, iron containing, 1 antikoerper, alcohol dehydrogenase, iron containing 1 S homeolog antikoerper, adhfe1 antikoerper, ADHFE1 antikoerper, adhfe1.S antikoerper, Adhfe1 antikoerper
- Hintergrund
- ADHFE1 is hydroxyacid-oxoacid transhydrogenase, which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues.
- Molekulargewicht
- 50 kDa (MW of target protein)
-