NECAB3 Antikörper (N-Term)

Produktnummer ABIN632067

Produktdetails anti-NECAB3 Antikörper

Target: NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NECAB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NECAB3 antibody was raised against the N terminal of NECAB3

Aufreinigung: Affinity purified

Immunogen: NECAB3 antibody was raised using the N terminal of NECAB3 corresponding to a region with amino acids MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NECAB3 Blocking Peptide, catalog no. 33R-5616, is also available for use as a blocking control in assays to test for specificity of this NECAB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NECAB3

Target: NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))

Andere Bezeichnung: NECAB3 (NECAB3 Produkte)

Synonyme: Apba2bp antikoerper, APBA2BP antikoerper, NECAB3 antikoerper, EFCBP3 antikoerper, NIP1 antikoerper, STIP3 antikoerper, SYTIP2 antikoerper, XB51 antikoerper, dJ63M2.4 antikoerper, dJ63M2.5 antikoerper, 2900010M17Rik antikoerper, AI853434 antikoerper, Nip1 antikoerper, N-terminal EF-hand calcium binding protein 3 antikoerper, Necab3 antikoerper, NECAB3 antikoerper

Hintergrund: The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 44 kDa (MW of target protein)