CYP27C1 Antikörper (Middle Region)
-
- Target Alle CYP27C1 Antikörper anzeigen
- CYP27C1 (Cytochrome P450, Family 27, Subfamily C, Polypeptide 1 (CYP27C1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CYP27C1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CYP27 C1 antibody was raised against the middle region of CYP27 1
- Aufreinigung
- Affinity purified
- Immunogen
- CYP27 C1 antibody was raised using the middle region of CYP27 1 corresponding to a region with amino acids VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL
- Top Product
- Discover our top product CYP27C1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CYP27C1 Blocking Peptide, catalog no. 33R-9856, is also available for use as a blocking control in assays to test for specificity of this CYP27C1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP27C1 (Cytochrome P450, Family 27, Subfamily C, Polypeptide 1 (CYP27C1))
- Andere Bezeichnung
- CYP27C1 (CYP27C1 Produkte)
- Synonyme
- zgc:172278 antikoerper, cytochrome P450 family 27 subfamily C member 1 antikoerper, cytochrome P450, family 27, subfamily C, polypeptide 1 antikoerper, CYP27C1 antikoerper, cyp27c1 antikoerper
- Hintergrund
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Molekulargewicht
- 43 kDa (MW of target protein)
-