FASTKD2 Antikörper (Middle Region)

Produktnummer ABIN631749

Produktdetails anti-FASTKD2 Antikörper

Target: FASTKD2 (FAST Kinase Domains 2 (FASTKD2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FASTKD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FASTKD2 antibody was raised against the middle region of FASTKD2

Aufreinigung: Affinity purified

Immunogen: FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FASTKD2 Blocking Peptide, catalog no. 33R-2200, is also available for use as a blocking control in assays to test for specificity of this FASTKD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FASTKD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FASTKD2

Target: FASTKD2 (FAST Kinase Domains 2 (FASTKD2))

Andere Bezeichnung: FASTKD2 (FASTKD2 Produkte)

Synonyme: si:ch211-103i6.5 antikoerper, KIAA0971 antikoerper, 2810421I24Rik antikoerper, RGD1307883 antikoerper, FAST kinase domains 2 antikoerper, FASTKD2 antikoerper, fastkd2 antikoerper, Fastkd2 antikoerper

Hintergrund: This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.

Molekulargewicht: 81 kDa (MW of target protein)