PCSK4 Antikörper (N-Term)

Produktnummer ABIN631599

Produktdetails anti-PCSK4 Antikörper

Target: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCSK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCSK4 antibody was raised against the N terminal of PCSK4

Aufreinigung: Affinity purified

Immunogen: PCSK4 antibody was raised using the N terminal of PCSK4 corresponding to a region with amino acids VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCSK4 Blocking Peptide, catalog no. 33R-9828, is also available for use as a blocking control in assays to test for specificity of this PCSK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCSK4

Target: PCSK4 (Proprotein Convertase Subtilisin/kexin Type 4 (PCSK4))

Andere Bezeichnung: PCSK4 (PCSK4 Produkte)

Synonyme: PC4 antikoerper, SPC5 antikoerper, AI647044 antikoerper, L21221 antikoerper, NEC 3 antikoerper, NEC3 antikoerper, PCSK4 antikoerper, pc4 antikoerper, spc5 antikoerper, MGC146505 antikoerper, pcsk4 antikoerper, proprotein convertase subtilisin/kexin type 4 antikoerper, proprotein convertase subtilisin/kexin type 4 L homeolog antikoerper, PCSK4 antikoerper, Pcsk4 antikoerper, pcsk4 antikoerper, pcsk4.L antikoerper

Hintergrund: PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin.

Molekulargewicht: 83 kDa (MW of target protein)