In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Catalase (CAT) Antikörper

Antigen

Catalase (CAT)
Synonyme
MGC138422, MGC138424, Cas1, Cs-1, Cas-1, 2210418N07, CS1, RATCATL, RATCAT01, fb68a12, wu:fb68a12, CAT, CATA, CT21282, DMCATHPO, DROCATHPO, U00145, bs36h11.y1, DmelCG6871, CG6871, MGC128112, CATALASE,  ... mehr anzeigen
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen
Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN631595
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung
Anwendungen Alternativen Sekundärantikörper Varianten zurück nach oben

Weitere Bezeichnung Catalase
Immunogen Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG
Beschreibung This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells.
Molekulargewicht 58 kDa (MW of target protein)
Synonyme MGC138422, MGC138424, Cas1, Cs-1, Cas-1, 2210418N07, CS1, RATCATL, RATCAT01, fb68a12, wu:fb68a12, CAT, CATA, CT21282, DMCATHPO, DROCATHPO, U00145, bs36h11.y1, DmelCG6871, CG6871, MGC128112, CATALASE, CATALASE 2, T12J5.2, Cat, GB11648, catalase, MGC147040, DKFZp469E0232

Anwendungen
Alternativen Sekundärantikörper Varianten zurück nach oben

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAT antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Krebs, Organelle, Hitzeschockproteine, Zell-/Gewebemarker
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen
Anwendungen Sekundärantikörper Varianten zurück nach oben

Alternativen zu Antigen "Catalase (CAT)", Typ "Antikörper" finden
Wirte Kaninchen (106), Maus (18), Ziege (8), Schaf (7), Mehrere Wirte (1)
Reaktivitäten Human (90), Maus (52), Ratte (Rattus) (48), Rind (Kuh) (25), Schwein (20), Hund (16), Huhn (5), Pferd (5), Schaf (5), Säugetiere (4), Kaninchen (4), Meerschweinchen (2), Alle Spezies (1), Ricinus communis (1)
Applikationen Western Blot (WB) (80), Immunfluoreszenz (IF) (47), Durchflusszytometrie (FACS) (38), Enzyme Immunoassay (EIA) (35), ELISA (33), Immunpräzipitation (IP) (27), Immunhistochemie (Paraffinschnitte) (IHC (p)) (16), Immunhistochemie (IHC) (12), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (11), Radioimmunoassay (RIA) (8), Dot Blot (Dot) (6), ELISA (Detektionsantikörper) (4), Immunzytochemie (ICC) (3), Immunodiffusion (ID) (3), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (2), Immunelektronenmikroskopie (EM) (1), Immunelektrophorese (IEP) (1)
Konjugate Biotin (10), HRP (7), Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy5.5 (2), PE,Cy7 (2), RBITC (2), Alexa Flour 488 (1)
Epitope AA 15-262 (1), AA 159-188 (1), Ab-385 (1), N-Term (1), internal (1), pTyr385 (1)