RDM1 Antikörper (Middle Region)

Produktnummer ABIN631469

Produktdetails anti-RDM1 Antikörper

Target: RDM1 (RAD52 Motif 1 (RDM1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RDM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RDM1 antibody was raised against the middle region of RDM1

Aufreinigung: Affinity purified

Immunogen: RDM1 antibody was raised using the middle region of RDM1 corresponding to a region with amino acids NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RDM1 Blocking Peptide, catalog no. 33R-6889, is also available for use as a blocking control in assays to test for specificity of this RDM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RDM1

Target: RDM1 (RAD52 Motif 1 (RDM1))

Andere Bezeichnung: RDM1 (RDM1 Produkte)

Synonyme: RAD52B antikoerper, 2410008M22Rik antikoerper, AW212028 antikoerper, Rad52b antikoerper, RDM1 antikoerper, rad52b antikoerper, RAD52 motif containing 1 antikoerper, RAD52 motif 1 antikoerper, RDM1 antikoerper, Rdm1 antikoerper, rdm1 antikoerper

Hintergrund: RDM1 is a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. It contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization.

Molekulargewicht: 26 kDa (MW of target protein)