OSBPL3 Antikörper (N-Term)

Produktnummer ABIN631463

Produktdetails anti-OSBPL3 Antikörper

Target: OSBPL3 (Oxysterol Binding Protein-Like 3 (OSBPL3))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OSBPL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OSBPL3 antibody was raised against the N terminal of OSBPL3

Aufreinigung: Affinity purified

Immunogen: OSBPL3 antibody was raised using the N terminal of OSBPL3 corresponding to a region with amino acids MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSBPL3 Blocking Peptide, catalog no. 33R-6237, is also available for use as a blocking control in assays to test for specificity of this OSBPL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSBPL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OSBPL3

Target: OSBPL3 (Oxysterol Binding Protein-Like 3 (OSBPL3))

Andere Bezeichnung: OSBPL3 (OSBPL3 Produkte)

Synonyme: osbpl3 antikoerper, zgc:101089 antikoerper, OSBPL3 antikoerper, ORP-3 antikoerper, ORP3 antikoerper, OSBP3 antikoerper, 1200014M06Rik antikoerper, 6720421I08Rik antikoerper, A530055M08 antikoerper, RGD1564287 antikoerper, oxysterol binding protein like 3 antikoerper, oxysterol binding protein-like 3a antikoerper, oxysterol binding protein-like 3 antikoerper, OSBPL3 antikoerper, osbpl3a antikoerper, osbpl3 antikoerper, Osbpl3 antikoerper

Hintergrund: This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified.

Molekulargewicht: 98 kDa (MW of target protein)