RAB1A Antikörper (Middle Region)

Produktnummer ABIN631433

Produktdetails anti-RAB1A Antikörper

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB1 A antibody was raised against the middle region of RAB1

Aufreinigung: Affinity purified

Immunogen: RAB1 A antibody was raised using the middle region of RAB1 corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB1A Blocking Peptide, catalog no. 33R-1303, is also available for use as a blocking control in assays to test for specificity of this RAB1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB1A

Target: RAB1A (RAB1A, Member RAS Oncogene Family (RAB1A))

Andere Bezeichnung: RAB1A (RAB1A Produkte)

Synonyme: RAB1 antikoerper, YPT1 antikoerper, RAS antikoerper, RAB1B antikoerper, fb53a02 antikoerper, oncogene antikoerper, wu:fb53a02 antikoerper, si:zc101n13.3 antikoerper, rab1 antikoerper, MGC53138 antikoerper, RAB1A antikoerper, AAF55873 antikoerper, CG3320 antikoerper, DRAB1 antikoerper, DRab1 antikoerper, Dm Rab1 antikoerper, DmRab1 antikoerper, Dmel\\CG3320 antikoerper, RAB1a antikoerper, Rab1a antikoerper, dRab1 antikoerper, dar6 antikoerper, drab1 antikoerper, DDBDRAFT_0185730 antikoerper, DDBDRAFT_0191476 antikoerper, DDB_0185730 antikoerper, DDB_0191476 antikoerper, Gtbp antikoerper, Rab-1 antikoerper, Rab1A antikoerper, Ypt1 antikoerper, mKIAA3012 antikoerper, Ac2-048 antikoerper, Rab1 antikoerper, Rab1r antikoerper, RAB1A, member RAS oncogene family antikoerper, RAB1A, member RAS oncogene family b antikoerper, RAB1A, member RAS oncogene family L homeolog antikoerper, RAB1B, member RAS oncogene family antikoerper, CG3320 gene product from transcript CG3320-RA antikoerper, rab1A protein antikoerper, PfRab1a antikoerper, hypothetical protein antikoerper, Rab GTPase antikoerper, angiogenin antikoerper, RAB1A antikoerper, rab1ab antikoerper, rab1a.L antikoerper, RAB1B antikoerper, rab1a antikoerper, Rab1 antikoerper, rab1A antikoerper, Rab1a antikoerper, ANG antikoerper

Hintergrund: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom