AMOTL1 Antikörper (N-Term)
-
- Target Alle AMOTL1 Antikörper anzeigen
- AMOTL1 (Angiomotin Like 1 (AMOTL1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AMOTL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AMOTL1 antibody was raised against the N terminal of AMOTL1
- Aufreinigung
- Affinity purified
- Immunogen
- AMOTL1 antibody was raised using the N terminal of AMOTL1 corresponding to a region with amino acids LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEE
- Top Product
- Discover our top product AMOTL1 Primärantikörper
-
anti-Angiomotin Like 1 (AMOTL1) (AA 1-956) antibody
AMOTL1 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Angiomotin Like 1 (AMOTL1) antibodyAMOTL1 Reaktivität: Human IF, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Angiomotin Like 1 (AMOTL1) antibodyAMOTL1 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Angiomotin Like 1 (AMOTL1) (AA 1-956) antibodyAMOTL1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Angiomotin Like 1 (AMOTL1) (AA 144-193) antibodyAMOTL1 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Kaninchen, Fledermaus, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Angiomotin Like 1 (AMOTL1) (AA 441-490) antibodyAMOTL1 Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Angiomotin Like 1 (AMOTL1) (N-Term) antibodyAMOTL1 Reaktivität: Human, Maus, Rind (Kuh), Hund, Meerschweinchen, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AMOTL1 Blocking Peptide, catalog no. 33R-5487, is also available for use as a blocking control in assays to test for specificity of this AMOTL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMOTL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AMOTL1 (Angiomotin Like 1 (AMOTL1))
- Andere Bezeichnung
- AMOTL1 (AMOTL1 Produkte)
- Synonyme
- JEAP antikoerper, 2310010G08Rik antikoerper, 2310067L22Rik antikoerper, 4932416D09Rik antikoerper, mFLJ00155 antikoerper, angiomotin like 1 antikoerper, angiomotin-like 1 antikoerper, AMOTL1 antikoerper, Amotl1 antikoerper
- Hintergrund
- AMOTL1 is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation.
- Molekulargewicht
- 106 kDa (MW of target protein)
-
