EPB41 Antikörper (N-Term)

Produktnummer ABIN631411

Produktdetails anti-EPB41 Antikörper

Target: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPB41 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EPB41 antibody was raised against the N terminal of EPB41

Aufreinigung: Affinity purified

Immunogen: EPB41 antibody was raised using the N terminal of EPB41 corresponding to a region with amino acids SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPB41 Blocking Peptide, catalog no. 33R-8404, is also available for use as a blocking control in assays to test for specificity of this EPB41 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPB41 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPB41

Target: EPB41 (Erythrocyte Membrane Protein Band 4.1 (Elliptocytosis 1, RH-Linked) (EPB41))

Andere Bezeichnung: EPB41 (EPB41 Produkte)

Synonyme: P4.1R antikoerper, epb41 antikoerper, wu:fb70c02 antikoerper, EPB41 antikoerper, el1 antikoerper, 4.1r antikoerper, 4.1R antikoerper, EL1 antikoerper, HE antikoerper, AI415518 antikoerper, D4Ertd442e antikoerper, Elp-1 antikoerper, Elp1 antikoerper, Epb41 antikoerper, mKIAA4056 antikoerper, erythrocyte membrane protein band 4.1b antikoerper, erythrocyte membrane protein band 4.1 antikoerper, erythrocyte membrane protein band 4.1 L homeolog antikoerper, epb41b antikoerper, EPB41 antikoerper, epb41 antikoerper, epb41.L antikoerper, Epb41 antikoerper

Hintergrund: Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene, the beta-spectrin gene, or the band 3 gene.

Molekulargewicht: 85 kDa (MW of target protein)